PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05449.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 368aa    MW: 41388.5 Da    PI: 11.1473
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05449.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92.1e-17274321148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc05449.1.g00010.1.am.mk 274 KGAWTKEEDQRLIAYIKAHGEGSWRSLPKAAGLLRCGKSCRLRWMNYL 321
                                   79******************************99************97 PP

2Myb_DNA-binding50.16.4e-16327368144
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                                   rg++T+++del+++++++lG++ W++Ia  ++ gRt++++k++w
  Zmw_sc05449.1.g00010.1.am.mk 327 RGNFTEDDDELIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYW 368
                                   89********************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23265324IPR009057Homeodomain-like
PROSITE profilePS5129417.023269321IPR017930Myb domain
SuperFamilySSF466891.12E-29273368IPR009057Homeodomain-like
SMARTSM007171.1E-13273323IPR001005SANT/Myb domain
PfamPF002491.3E-15274321IPR001005SANT/Myb domain
CDDcd001671.76E-10276321No hitNo description
PROSITE profilePS5129425.161322368IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-22325368IPR009057Homeodomain-like
SMARTSM007173.0E-8326368IPR001005SANT/Myb domain
PfamPF002494.9E-14327368IPR001005SANT/Myb domain
CDDcd001672.04E-10329368No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MHFAESDASP TGWIRPVQVQ KRKNHSFSFL SFDSTLAPVA QLDVTRIHRI CLLLARARAR  60
RGPATVQPAR ADCTGNIEFV PLEQQPADLP IATPRADFAA RAIASTKALS CRREPPASAR  120
MLGRPRLASS LLSATTRNLS VTIVAGKWRS TGKWVCARSN AALPLRGVES MKRERNHEKE  180
KAQTRLSFHP RTRLAPIYTR TFPASLHLSF PCCDNQFHQR CSGISLQANS ARRSKEDSSA  240
KEQRKHLRCA GGEARRRRPI MGRSPCCEKA HTNKGAWTKE EDQRLIAYIK AHGEGSWRSL  300
PKAAGLLRCG KSCRLRWMNY LRPDLKRGNF TEDDDELIIK LHALLGNKWS LIAGQLPGRT  360
DNEIKNYW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2627336826120MYB TRANSFORMING PROTEIN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448